ABCD_AU852 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9NRD5 Homo sapiens (Human) UniProt: Q9EP80 Rattus norvegicus (Rat) UniProt: Q62083 Mus musculus (Mouse) |
| Target name | PICK1, PRKCABP, PRKCA-binding protein, Protein interacting with C kinase 1, Protein kinase C-alpha-binding protein |
| Epitope | Sequence:EEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMS |
| Antibody information | |
| Antibody name | L20/8R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: L20_8.pdf Addgene: 128630 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |