ABCD_AU853 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63881 Rattus norvegicus (Rat) UniProt: Q63881 Rattus norvegicus (Rat) UniProt: Q9Z0V2 Mus musculus (Mouse) |
| Target name | Kcnd2, Potassium voltage-gated channel subfamily D member 2, RK5, Shal1, Voltage-gated potassium channel subunit Kv4.2 |
| Epitope | Sequence:GSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKSFRIPNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
| Antibody information | |
| Antibody name | L28/4R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L28_4.pdf Addgene: 149453 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |