Expasy logo

ABCD

ABCD_AU853 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q63881 Rattus norvegicus (Rat)
UniProt: Q63881 Rattus norvegicus (Rat)
UniProt: Q9Z0V2 Mus musculus (Mouse)
Target name Kcnd2, Potassium voltage-gated channel subfamily D member 2, RK5, Shal1, Voltage-gated potassium channel subunit Kv4.2
Epitope Sequence:
GSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCC
SRRHKKSFRIPNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQ
PYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Antibody information
Antibody name L28/4R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: L28_4.pdf
Addgene: 149453
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).