ABCD_AU854 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: A2ANU3 Mus musculus (Mouse) UniProt: Q9H7V2 UniProt: Q58DZ9 Rattus norvegicus (Rat) |
| Target name | Syndig1, Tmem90b, Synapse differentiation-inducing gene protein 1, SynDIG1, Dispanin subfamily C member 2, DSPC2, Transmembrane protein 90B |
| Epitope | Sequence:MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRDHLG |
| Antibody information | |
| Antibody name | L42/17R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L42_17.pdf Addgene: 128632 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |