Expasy logo

ABCD

ABCD_AU867 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q925N3 Rattus norvegicus (Rat)
UniProt: Q8IYB4 Homo sapiens (Human)
UniProt: Q8C437 Mus musculus (Mouse)
Target name Pex5l, Pex2, Pex5r, Trip8b, PEX5-related protein, PEX5-like protein, Peroxin-5-related protein, TPR-containing Rab8b-interacting protein, Tetratricopeptide repeat-containing Rab8b-interacting protein, Pex5Rp, TRIP8b
Epitope Sequence:
MYQGHMQGKGSRAADKAVAMVMKEIPREESAEEKPLLTMTSQLVNEQQESRPLLSPSIDD
FLCETKSEAIAKPVTSNTAVLTTGLDLLDLSEPVSQTQTKAKKSESSSKSSSLKKKADGS
DLISADAEQRAQALRGPETSSLDLDIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRAG
SKELLWSSEHRS
Antibody information
Antibody name N212/3R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N212_3.pdf
Addgene: 114473
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).