ABCD_AU867 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q925N3 Rattus norvegicus (Rat) UniProt: Q8IYB4 Homo sapiens (Human) UniProt: Q8C437 Mus musculus (Mouse) |
| Target name | Pex5l, Pex2, Pex5r, Trip8b, PEX5-related protein, PEX5-like protein, Peroxin-5-related protein, TPR-containing Rab8b-interacting protein, Tetratricopeptide repeat-containing Rab8b-interacting protein, Pex5Rp, TRIP8b |
| Epitope | Sequence:MYQGHMQGKGSRAADKAVAMVMKEIPREESAEEKPLLTMTSQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAVLTTGLDLLDLSEPVSQTQTKAKKSESSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLDIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRAGSKELLWSSEHRS |
| Antibody information | |
| Antibody name | N212/3R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N212_3.pdf Addgene: 114473 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |