ABCD_AU868 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9QX74 Rattus norvegicus (Rat) UniProt: Q80Z38 Mus musculus (Mouse) UniProt: Q9UPX8 Homo sapiens (Human) UniProt: Q9WV48 Rattus norvegicus (Rat) UniProt: D3YZU1 Mus musculus (Mouse) UniProt: Q9Y566 Homo sapiens (Human) UniProt: Q9JLU4 Rattus norvegicus (Rat) UniProt: Q4ACU6 Mus musculus (Mouse) UniProt: Q9BYB0 Homo sapiens (Human) |
| Target name | pan-Shank Shank2, Cortbp1, SH3 and multiple ankyrin repeat domains protein 2, Shank2, Cortactin-binding protein 1, CortBP1, GKAP SAPAP-interacting protein, Proline-rich synapse-associated protein 1, ProSAP1, SPANK-3 Shank1, SH3 and multiple ankyrin repeat domains protein 1, Shank1, GKAP SAPAP-interacting protein, SPANK-1, Somatostatin receptor-interacting protein, SSTR-interacting protein, SSTRIP Shank3, Prosap2, SH3 and multiple ankyrin repeat domains protein 3, Shank3, Proline-rich synapse-associated protein 2, ProSAP2, SPANK-2 |
| Epitope | Sequence:SLGSYAPGPRSRSPSLNRLGGAGEDGKRPQPPHWHVGSPFTPGANKDSLSTFEYPGPRRKLYSAVPGRLFVAIKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRSKKLFRHYTVGSYDSFDAASDCIIEDKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIE |
| Antibody information | |
| Antibody name | N23B/49R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: N23B_49.pdf Addgene: 128637 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |