Expasy logo

ABCD

ABCD_AU869 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q63273 Rattus norvegicus (Rat)
UniProt: Q61626 Mus musculus (Mouse)
Target name Grik5, Glutamate receptor ionotropic kainate 5, GluK5, Glutamate receptor KA-2, KA2
Epitope Sequence:
EFIWSTRRSAESEEVSVCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMR
LSNGKLYSAGAGGDAGAHGGPQRLLDDPGPPGGPRPQAPTPCTHVRVCQECRRIQALRAS
GAGAPPRGLGTPAEATSPPRPRPGPTGPRELTEHE
Antibody information
Antibody name N279B/27R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N279B_27.pdf
Addgene: 149451
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.