Expasy logo

ABCD

ABCD_AU870 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q62634 Rattus norvegicus (Rat)
UniProt: Q3TXX4 Mus musculus (Mouse)
UniProt: Q9P2U7 Homo sapiens (Human)
Target name Slc17a7, Bnpi, Vglut1, Vesicular glutamate transporter 1, VGluT1, Brain-specific Na(+)-dependent inorganic phosphate cotransporter, Solute carrier family 17 member 7
Epitope Sequence:
KQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPSYGATHSTVQPPRP
PPPVRDY
Antibody information
Antibody name N28/9R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N28_9.pdf
Addgene: 128638
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.