ABCD_AU870 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q62634 Rattus norvegicus (Rat) UniProt: Q3TXX4 Mus musculus (Mouse) UniProt: Q9P2U7 Homo sapiens (Human) |
| Target name | Slc17a7, Bnpi, Vglut1, Vesicular glutamate transporter 1, VGluT1, Brain-specific Na(+)-dependent inorganic phosphate cotransporter, Solute carrier family 17 member 7 |
| Epitope | Sequence:KQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY |
| Antibody information | |
| Antibody name | N28/9R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N28_9.pdf Addgene: 128638 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |