ABCD_AU872 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9Z258 Rattus norvegicus (Rat) UniProt: Q6ZPR4 Mus musculus (Mouse) UniProt: Q5JUK3 Homo sapiens (Human) |
| Target name | Kcnt1, Slack, Potassium channel subfamily T member 1, Sequence like a calcium-activated potassium channel subunit |
| Epitope | Sequence:DEMNDHHQNTLSYVLINPPPDTRLEPNDIVYLIRSDPLAHVTSSSQSRKSSCSNKLSSCNPETRDETQL |
| Antibody information | |
| Antibody name | N3/26R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N3_26.pdf Addgene: 140064 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |