ABCD_AU874 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63563 Rattus norvegicus (Rat) UniProt: O60706 Homo sapiens (Human) UniProt: P70170 Mus musculus (Mouse) |
| Target name | Abcc9, Sur2, ATP-binding cassette sub-family C member 9, Sulfonylurea receptor 2 |
| Epitope | Sequence:VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM |
| Antibody information | |
| Antibody name | N323B/20R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N323B_20.pdf Addgene: 114480 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |