Expasy logo

ABCD

ABCD_AU875 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q2M1K9 Homo sapiens (Human)
UniProt: Q80TS5 Mus musculus (Mouse)
Target name ZNF423, NPHP14, OAZ, Zinc finger protein 423, Olf1
EBF-associated zinc finger protein, hOAZ, Smad- and Olf-interacting zinc finger protein
Epitope Sequence:
MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDED
MEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIG
DGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRS

Antibody information
Antibody name N328B/37R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N328B_37.pdf
Addgene: 140077
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).