ABCD_AU875 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q2M1K9 Homo sapiens (Human) UniProt: Q80TS5 Mus musculus (Mouse) |
| Target name | ZNF423, NPHP14, OAZ, Zinc finger protein 423, Olf1 EBF-associated zinc finger protein, hOAZ, Smad- and Olf-interacting zinc finger protein |
| Epitope | Sequence:MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDEDMEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRS |
| Antibody information | |
| Antibody name | N328B/37R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N328B_37.pdf Addgene: 140077 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |