ABCD_AU878 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P78334 Homo sapiens (Human) UniProt: Q9ES14 Rattus norvegicus (Rat) |
| Target name | GABRE, Gamma-aminobutyric acid receptor subunit epsilon, GABA(A) receptor subunit epsilon |
| Epitope | Sequence:KNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSWKLFQFDFTGVSNK |
| Antibody information | |
| Antibody name | N413/67R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N413_67.pdf Addgene: 114478 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |