ABCD_AU879 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P31644 Homo sapiens (Human) UniProt: P19969 Rattus norvegicus (Rat) UniProt: Q8BHJ7 Mus musculus (Mouse) |
| Target name | GABRA5, Gamma-aminobutyric acid receptor subunit alpha-5, GABA(A) receptor subunit alpha-5 |
| Epitope | Sequence:VILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTY |
| Antibody information | |
| Antibody name | N415/24R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N415_24.pdf Addgene: 149456 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |