ABCD_AU884 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: B0F2B4 |
| Target name | Nlgn4l, Nl4*, Nlgn4, Nlgn4x, Neuroligin 4-like, Neuroligin-4, NL-4 |
| Epitope | Sequence:YKKDKRRHETHRRPPPPRPPQAPPSAAAADRNPRPDPGPAGRRGGECGAVVTAMAAEASAGGLGHDGVGGVGVGGVIGGVAGLRLACPPDYALTLRRSPDDVPRAGAGPGTMTLIPGALGGGGGGAVHGFNTFGSGVGVAGVAGVATSQAGPGLPHGHSTTRV |
| Antibody information | |
| Antibody name | N98/7R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N98_7.pdf Addgene: 140081 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |