ABCD_AU886 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q02297 Homo sapiens (Human) |
| Target name | NRG1, GGF, HGL, HRGA, NDF, SMDF, Pro-neuregulin-1, membrane-bound isoform, Pro-NRG1 |
| Epitope | Sequence:KKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISK |
| Antibody information | |
| Antibody name | N120A/9.1R |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: N120A_9.pdf Addgene: 114507 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |