ABCD_AU887 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: Q00960 Rattus norvegicus (Rat) UniProt: Q00960 Rattus norvegicus (Rat) UniProt: Q01097 Mus musculus (Mouse) |
Target name | Grin2b, Glutamate receptor ionotropic, NMDA 2B, GluN2B, Glutamate [NMDA] receptor subunit epsilon-2, N-methyl D-aspartate receptor subtype 2B, NMDAR2B, NR2B |
Epitope | Sequence:AVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVPS |
Antibody information | |
Antibody name | N59/36 |
Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
Cross-references | NeuroMab: N59_36.pdf |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|