Expasy logo

ABCD

ABCD_AU889 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9JM15 Rattus norvegicus (Rat)
UniProt: Q8K2P7 Mus musculus (Mouse)
UniProt: Q9H2H9 Homo sapiens (Human)
Target name Slc38a1, Ata1, Glnt, Sa2, Sat1, Snat1, Sodium-coupled neutral amino acid transporter 1, Amino acid transporter A1, rATA1, Glutamine transporter, N-system amino acid transporter 2, Solute carrier family 38 member 1, System A amino acid transporter 1, System A transporter 2, System N amino acid transporter 1
Epitope Sequence:
MMHFKSGLELTELQNMTVPEDDNVSNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
RKC
Antibody information
Antibody name N104/32.1R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N104_32.pdf
Addgene: 114517
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).