ABCD_AU896 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q92953 Homo sapiens (Human) UniProt: Q63099 Rattus norvegicus (Rat) UniProt: A6H8H5 Mus musculus (Mouse) |
| Target name | KCNB2, Potassium voltage-gated channel subfamily B member 2, Voltage-gated potassium channel subunit Kv2.2 |
| Epitope | Sequence:MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTRL |
| Antibody information | |
| Antibody name | K37/89 |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: K37_89.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |