Expasy logo

ABCD

ABCD_AU896 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q92953 Homo sapiens (Human)
UniProt: Q63099 Rattus norvegicus (Rat)
UniProt: A6H8H5 Mus musculus (Mouse)
Target name KCNB2, Potassium voltage-gated channel subfamily B member 2, Voltage-gated potassium channel subunit Kv2.2
Epitope Sequence:
MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTR
L
Antibody information
Antibody name K37/89
Applications Immunohistochemistry, Immunoprecipitation, Western blot
Cross-references NeuroMab: K37_89.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).