ABCD_AU901 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P97846 Rattus norvegicus (Rat) UniProt: P78357 Homo sapiens (Human) UniProt: O54991 Mus musculus (Mouse) |
| Target name | Cntnap1, Caspr, Nrxn4, Contactin-associated protein 1, Caspr, Caspr1, Neurexin IV, Neurexin-4, Paranodin, p190 |
| Epitope | Sequence:QNHRYKGSYHTNEPKATHDSHPGGKAPLPPSGPAQAPAPTPAPTQVPTPAPAPASGPGPRDQNLPQILEESRSE |
| Antibody information | |
| Antibody name | K65/35R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: K65_35.pdf Addgene: 177445 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |