ABCD_AU905 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q62897 Rattus norvegicus (Rat) UniProt: Q9UK17 Homo sapiens (Human) UniProt: Q9Z0V1 Mus musculus (Mouse) |
| Target name | Kcnd3, Potassium voltage-gated channel subfamily D member 3, Voltage-gated potassium channel subunit Kv4.3 |
| Epitope | Sequence:RADKRRAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHSGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASP |
| Antibody information | |
| Antibody name | K75/30 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: K75_30.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |