ABCD_AU910 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q6MG82 Rattus norvegicus (Rat) UniProt: O35449 Mus musculus (Mouse) UniProt: Q99946 Homo sapiens (Human) |
| Target name | Prrt1, Ng5, SynDIG4, Proline-rich transmembrane protein 1, Dispanin subfamily D member 1, DSPD1, Synapse differentiation-induced protein 4 |
| Epitope | Sequence:MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPIPPPQTAPSSHHHHHHHYHQSGTATLPRLGAGGLAS |
| Antibody information | |
| Antibody name | L102/45R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L102_45.pdf Addgene: 177450 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |