ABCD_AU910 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q6MG82 UniProt: O35449 UniProt: Q99946 Homo sapiens (Human) |
| Target name | Prrt1, Ng5, SynDIG4, Proline-rich transmembrane protein 1, Dispanin subfamily D member 1, DSPD1, Synapse differentiation-induced protein 4 |
| Epitope | Sequence:MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPIPPPQTAPSSHHHHHHHYHQSGTATLPRLGAGGLAS |
| Antibody information | |
| Antibody name | L102/45R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L102_45.pdf Addgene: 177450 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |