Expasy logo

ABCD

ABCD_AU914 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q69ZK9 Mus musculus (Mouse)
UniProt: Q62888 Rattus norvegicus (Rat)
UniProt: Q8NFZ4 Homo sapiens (Human)
Target name Nlgn2, Neuroligin-2
Epitope Sequence:
YKRDRRQELRCRRLSPPGGSGSGVPGGGPLLPTAGRELPPEEELVSLQLKRGGGVGADPA
EALRPACPPDYTLALRRAPDDVPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPT
ATSHNNTLPHPHSTTRV
Antibody information
Antibody name L107/39R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: L107_39.pdf
Addgene: 177452
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).