ABCD_AU914 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: Q69ZK9 Mus musculus (Mouse) UniProt: Q62888 Rattus norvegicus (Rat) UniProt: Q8NFZ4 Homo sapiens (Human) |
Target name | Nlgn2, Neuroligin-2 |
Epitope | Sequence:YKRDRRQELRCRRLSPPGGSGSGVPGGGPLLPTAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDDVPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV |
Antibody information | |
Antibody name | L107/39R |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: L107_39.pdf Addgene: 177452 |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|