ABCD_AU914 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q69ZK9 Mus musculus (Mouse) UniProt: Q62888 Rattus norvegicus (Rat) UniProt: Q8NFZ4 Homo sapiens (Human) |
| Target name | Nlgn2, Neuroligin-2 |
| Epitope | Sequence:YKRDRRQELRCRRLSPPGGSGSGVPGGGPLLPTAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDDVPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV |
| Antibody information | |
| Antibody name | L107/39R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L107_39.pdf Addgene: 177452 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |