ABCD_AU915 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P01282 Homo sapiens (Human) UniProt: P01283 Rattus norvegicus (Rat) |
| Target name | VIP, VIP peptides |
| Epitope | Sequence:HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILN |
| Antibody information | |
| Antibody name | L108/92R |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: L108_92.pdf Addgene: 177453 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |