ABCD_AU919 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P61278 Homo sapiens (Human) UniProt: P60042 Rattus norvegicus (Rat) UniProt: P60041 Mus musculus (Mouse) |
| Target name | SST, Somatostatin, Growth hormone release-inhibiting factor |
| Epitope | Sequence:APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC |
| Antibody information | |
| Antibody name | L111/118_258 |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: L111_118.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |