ABCD_AU929 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P01303 Homo sapiens (Human) UniProt: P57774 Mus musculus (Mouse) UniProt: P07808 Rattus norvegicus (Rat) |
| Target name | NPY, Pro-neuropeptide Y |
| Epitope | Sequence:AYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
| Antibody information | |
| Antibody name | L115/13 |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: L115_13.pdf Addgene: 177461 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |