ABCD_AU937 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P22676 Homo sapiens (Human) UniProt: Q08331 Mus musculus (Mouse) UniProt: P47728 Rattus norvegicus (Rat) |
| Target name | CALB2, CAB29, Calretinin, CR, 29 kDa calbindin |
| Epitope | Sequence:MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSR |
| Antibody information | |
| Antibody name | L122/6 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L122_6.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |