ABCD_AV212 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P29994 Rattus norvegicus (Rat) UniProt: Q14643 Homo sapiens (Human) UniProt: P11881 Mus musculus (Mouse) |
| Target name | Itpr1, Insp3r, Inositol 1,4,5-trisphosphate receptor type 1, IP3 receptor isoform 1, IP-3-R, IP3R 1, InsP3R1, Type 1 inositol 1,4,5-trisphosphate receptor, Type 1 InsP3 receptor |
| Epitope | Sequence:AMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQP |
| Antibody information | |
| Antibody name | L24/18 |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: L24_18.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |