Expasy logo

ABCD

ABCD_AV213 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q804I6 Carassius auratus (Goldfish)
UniProt: E7FE78 Danio rerio (Zebrafish) (Brachydanio rerio)
UniProt: Q9JJZ8 Mus musculus (Mouse)
UniProt: Q9ER32 Rattus norvegicus (Rat)
UniProt: P29974 Mus musculus (Mouse)
UniProt: Q62927 Rattus norvegicus (Rat)
Target name Cyclic nucleotide-gated channel subunit alpha 1b
Cnga3, Cng3, Cyclic nucleotide-gated cation channel alpha-3, Cone photoreceptor cGMP-gated channel subunit alpha, Cyclic nucleotide-gated channel alpha-3, CNG channel alpha-3, CNG-3, CNG3
Cnga1, Cncg, Cncg1, cGMP-gated cation channel alpha-1, Cyclic nucleotide-gated cation channel 1, Cyclic nucleotide-gated channel alpha-1, CNG channel alpha-1, CNG-1, CNG1, Cyclic nucleotide-gated channel, photoreceptor, Rod photoreceptor cGMP-gated channel subunit alpha
Epitope Sequence:
LDAKAMLEEKGRQILMKDNLLDLELAKQGPDPKVMEEKVIKIGSVLDDLQTRFARLLAEH
EAAQGKLKKRITKLEKKITDSSGVALSEMLDPELVTAKKEEKE
Antibody information
Antibody name L36/12
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: L36_12.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.