ABCD_AV213 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q804I6 Carassius auratus (Goldfish) UniProt: E7FE78 Danio rerio (Zebrafish) (Brachydanio rerio) UniProt: Q9JJZ8 Mus musculus (Mouse) UniProt: Q9ER32 Rattus norvegicus (Rat) UniProt: P29974 Mus musculus (Mouse) UniProt: Q62927 Rattus norvegicus (Rat) |
| Target name | Cyclic nucleotide-gated channel subunit alpha 1b Cnga3, Cng3, Cyclic nucleotide-gated cation channel alpha-3, Cone photoreceptor cGMP-gated channel subunit alpha, Cyclic nucleotide-gated channel alpha-3, CNG channel alpha-3, CNG-3, CNG3 Cnga1, Cncg, Cncg1, cGMP-gated cation channel alpha-1, Cyclic nucleotide-gated cation channel 1, Cyclic nucleotide-gated channel alpha-1, CNG channel alpha-1, CNG-1, CNG1, Cyclic nucleotide-gated channel, photoreceptor, Rod photoreceptor cGMP-gated channel subunit alpha |
| Epitope | Sequence:LDAKAMLEEKGRQILMKDNLLDLELAKQGPDPKVMEEKVIKIGSVLDDLQTRFARLLAEHEAAQGKLKKRITKLEKKITDSSGVALSEMLDPELVTAKKEEKE |
| Antibody information | |
| Antibody name | L36/12 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L36_12.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |