ABCD_AV215 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P15381 Oryctolagus cuniculus (Rabbit) UniProt: Q13936 Homo sapiens (Human) UniProt: Q01815 Mus musculus (Mouse) UniProt: P22002 Rattus norvegicus (Rat) |
| Target name | CACNA1C, CACH2, CACN2, CACNL1A1, CCHL1A1, Voltage-dependent L-type calcium channel subunit alpha-1C, Calcium channel L type alpha-1 polypeptide, Smooth muscle calcium channel blocker receptor, CACB-receptor, Voltage-gated calcium channel subunit alpha Cav1.2 |
| Epitope | Sequence:DNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLF |
| Antibody information | |
| Antibody name | L57/46R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: L57_46.pdf Addgene: 177485 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |