Expasy logo

ABCD

ABCD_AV215 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P15381 Oryctolagus cuniculus (Rabbit)
UniProt: Q13936 Homo sapiens (Human)
UniProt: Q01815 Mus musculus (Mouse)
UniProt: P22002 Rattus norvegicus (Rat)
Target name CACNA1C, CACH2, CACN2, CACNL1A1, CCHL1A1, Voltage-dependent L-type calcium channel subunit alpha-1C, Calcium channel L type alpha-1 polypeptide, Smooth muscle calcium channel blocker receptor, CACB-receptor, Voltage-gated calcium channel subunit alpha Cav1.2
Epitope Sequence:
DNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPH
RVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRT
SMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLR
TLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLF
Antibody information
Antibody name L57/46R
Applications Immunohistochemistry, Immunoprecipitation, Western blot
Cross-references NeuroMab: L57_46.pdf
Addgene: 177485
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).