ABCD_AV222 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q80ZD8 Mus musculus (Mouse) UniProt: Q86WK6 Homo sapiens (Human) UniProt: Q80ZD7 Rattus norvegicus (Rat) |
| Target name | Amigo1, Ali2, Amigo, Amphoterin-induced protein 1, AMIGO-1, Alivin-2 |
| Epitope | Sequence:CRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV |
| Antibody information | |
| Antibody name | L86/33.1.1 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L86_33.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |