Expasy logo

ABCD

ABCD_AV225 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q8TD43 Homo sapiens (Human)
UniProt: Q9ESQ5 Rattus norvegicus (Rat)
UniProt: Q7TN37 Mus musculus (Mouse)
Target name TRPM4, LTRPC4, Transient receptor potential cation channel subfamily M member 4, hTRPM4, Calcium-activated non-selective cation channel 1, Long transient receptor potential channel 4, LTrpC-4, LTrpC4, Melastatin-4
Epitope Sequence:
IAMFSYTFGKVQGNSDLYWKAQRYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP
QPSSPALEHFRVYLSKEAERKLLTWESVHKENFLLARARDKRESDSERLKRTSQKVDLAL
KQLGHIREYEQRLKVLEREVQQCSRVLGWVAEALSRSALLPPGGPPPPDLPGSKD
Antibody information
Antibody name L88/86
Applications Immunohistochemistry
Cross-references NeuroMab: L88_86.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.