ABCD_AV226 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q6MFX9 Rattus norvegicus (Rat) UniProt: Q63345 Rattus norvegicus (Rat) |
| Target name | Mog, Gabbr1, Rps15-ps, Ubd, Zfp57, Znrd1, Myelin-oligodendrocyte glycoprotein |
| Epitope | Sequence:MAGVWSLSLPSCLLSLLLLLQLSCSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTC |
| Antibody information | |
| Antibody name | L94/54 |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: L94_54.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |