ABCD_AV227 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63633 Rattus norvegicus (Rat) UniProt: Q9H2X9 Homo sapiens (Human) UniProt: Q91V14 Mus musculus (Mouse) |
| Target name | Slc12a5, Kcc2, Solute carrier family 12 member 5, Electroneutral potassium-chloride cotransporter 2, Furosemide-sensitive K-Cl cotransporter, K-Cl cotransporter 2, rKCC2, Neuronal K-Cl cotransporter |
| Epitope | Sequence:MEQRSQILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSAAQKNKG |
| Antibody information | |
| Antibody name | N1/12 |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: N1_12.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |