ABCD_AV232 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9JM15 Rattus norvegicus (Rat) UniProt: Q9H2H9 Homo sapiens (Human) UniProt: Q8K2P7 Mus musculus (Mouse) |
| Target name | Slc38a1, Ata1, Glnt, Sa2, Sat1, Snat1, Sodium-coupled neutral amino acid transporter 1, Amino acid transporter A1, rATA1, Glutamine transporter, N-system amino acid transporter 2, Solute carrier family 38 member 1, System A amino acid transporter 1, System A transporter 2, System N amino acid transporter 1 |
| Epitope | Sequence:MMHFKSGLELTELQNMTVPEDDNVSNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKRKC |
| Antibody information | |
| Antibody name | N104/37 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N104_37.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |