Expasy logo

ABCD

ABCD_AV244 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: O88705 Mus musculus (Mouse)
UniProt: Q9JKA8 Rattus norvegicus (Rat)
Target name Hcn3, Hac3, Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3, Hyperpolarization-activated cation channel 3, HAC-3
Epitope Sequence:
RAGPLLARGPWASTSRLPAPPARTLHASLSRTGRSQVSLLGPPPGGGARRLGPRGRPLSA
SQPSLPQRATGDGSPRRKGSGSERLPPSGLLAKPPGTVQPPRSSVPEPVTPRGPQISANM

Antibody information
Antibody name N141/28R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N141_28.pdf
Addgene: 177499
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).