| Antigen information |
|---|
| Target type |
Protein
|
|---|
| Target link |
UniProt: Q91XY5 Mus musculus (Mouse)
|
|---|
| Target name |
Pcdhga3, Protocadherin gamma A3, Protocadherin gamma subfamily A3
|
|---|
| Epitope |
Sequence:RLQASGNGLAGIPASHFVGLDGVQAFLQTYSQEVSLTAGSRKSHLIFPQPNYADTLISQESCGKSEPLIIPQDLLETKEDPTLPQ
|
|---|
| Antibody information |
|---|
| Antibody name |
N144/17
|
|---|
| Applications |
Immunohistochemistry, Western blot
|
|---|
| Cross-references |
NeuroMab: N144_17.pdf
|
|---|
| Publications |
PMID: 30667360
|
|---|
| Deposited by |
From UC Davis/NIH NeuroMab Facility
|
|---|
| Interested in this antibody? |
|---|
Contact the Geneva Antibody Facility to assess production feasibility or check here.
|
