Expasy logo

ABCD

ABCD_AV250 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link InterPro: IPR030736
InterPro: IPR030725
Target name Protocadherin gamma subfamily A, Gamma-protocadherin-A, Protocadherin gamma-A, PCDH-gamma-A
Epitope This antibody cross-reacts with several mouse Gamma-protocadherin-A proteins, but not with -B or -C proteins.
Sequence:
RLQASGNGLAGIPASHFVGLDGVQAFLQTYSQEVSLTAGSRKSHLIFPQPNYADTLISQE
SCGKSEPLIIPQDLLETKEDPTLPQ
Antibody information
Antibody name N144/32
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N144_32.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.