ABCD_AV250 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | InterPro: IPR030736 InterPro: IPR030725 |
| Target name | Protocadherin gamma subfamily A, Gamma-protocadherin-A, Protocadherin gamma-A, PCDH-gamma-A |
| Epitope | This antibody cross-reacts with several mouse Gamma-protocadherin-A proteins, but not with -B or -C proteins. Sequence:RLQASGNGLAGIPASHFVGLDGVQAFLQTYSQEVSLTAGSRKSHLIFPQPNYADTLISQESCGKSEPLIIPQDLLETKEDPTLPQ |
| Antibody information | |
| Antibody name | N144/32 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N144_32.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |