ABCD_AV251 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q8VEB1 Mus musculus (Mouse) UniProt: Q62833 Rattus norvegicus (Rat) UniProt: P34947 Homo sapiens (Human) UniProt: O70293 Mus musculus (Mouse) UniProt: P97711 Rattus norvegicus (Rat) UniProt: P43250 Homo sapiens (Human) |
| Target name | Grk5, Gprk5, G protein-coupled receptor kinase 5 , G protein-coupled receptor kinase GRK5 Grk6, Gprk6, G protein-coupled receptor kinase 6 , G protein-coupled receptor kinase GRK6 |
| Epitope | Sequence:GQSPFRGRKEKVKREEVDRRVLETEEVYSSKFSEEAKSICNMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLSPDLNRSQPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHRINSNHINSNSTGSS |
| Antibody information | |
| Antibody name | N145/20 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N145_20.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |