ABCD_AV255 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O75164 Homo sapiens (Human) |
| Target name | KDM4A, JHDM3A, JMJD2, JMJD2A, Lysine-specific demethylase 4A, JmjC domain-containing histone demethylation protein 3A, Jumonji domain-containing protein 2A, [histone H3]-trimethyl-L-lysine(36) demethylase 4A, [histone H3]-trimethyl-L-lysine(9) demethylase 4A |
| Epitope | Sequence:ARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIF |
| Antibody information | |
| Antibody name | N154/32 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N154_32.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |