| Antigen information |
|---|
| Target type |
Protein
|
|---|
| Target link |
UniProt: O75164 Homo sapiens (Human)
|
|---|
| Target name |
KDM4A, JHDM3A, JMJD2, JMJD2A, Lysine-specific demethylase 4A, JmjC domain-containing histone demethylation protein 3A, Jumonji domain-containing protein 2A, [histone H3]-trimethyl-L-lysine(36) demethylase 4A, [histone H3]-trimethyl-L-lysine(9) demethylase 4A
|
|---|
| Epitope |
Sequence:ARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIF
|
|---|
| Antibody information |
|---|
| Antibody name |
N154/32
|
|---|
| Applications |
Immunohistochemistry, Western blot
|
|---|
| Cross-references |
NeuroMab: N154_32.pdf
|
|---|
| Publications |
PMID: 30667360
|
|---|
| Deposited by |
From UC Davis/NIH NeuroMab Facility
|
|---|
| Would you like to obtain this antibody? |
|---|
It can be produced at the Geneva Antibody facility (for more information, please check here).
|
