ABCD_AV260 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q91XX1 Mus musculus (Mouse) |
| Target name | Pcdhgc3, Protocadherin gamma C3, Protocadherin gamma subfamily C, 3 |
| Epitope | Sequence:WKRSRDLYRAPVSSLYRTPGPSLHADAVRGGLMPPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAE |
| Antibody information | |
| Antibody name | N174B/27R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N174B_27.pdf Addgene: 164156 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |