Expasy logo

ABCD

ABCD_AV263 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q6Q760 Rattus norvegicus (Rat)
UniProt: Q8BXR5 Mus musculus (Mouse)
Target name Nalcn, Nca, Rb21, Vgcnl1, Sodium leak channel non-selective protein, Four domain-type voltage-gated ion channel alpha-1 subunit, Rb21-channel, Voltage gated channel-like protein 1
Epitope Sequence:
DTGKPQRKIGQWRLPSAPKPISHSVSSVNLRFGGRTTMKSVVCKMNPMPDTASCGSEVKK
WWTRQLTVESDESGDDLLDI
Antibody information
Antibody name N185/7R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N185_7.pdf
Addgene: 177508
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.