ABCD_AV263 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q6Q760 Rattus norvegicus (Rat) UniProt: Q8BXR5 Mus musculus (Mouse) |
| Target name | Nalcn, Nca, Rb21, Vgcnl1, Sodium leak channel non-selective protein, Four domain-type voltage-gated ion channel alpha-1 subunit, Rb21-channel, Voltage gated channel-like protein 1 |
| Epitope | Sequence:DTGKPQRKIGQWRLPSAPKPISHSVSSVNLRFGGRTTMKSVVCKMNPMPDTASCGSEVKKWWTRQLTVESDESGDDLLDI |
| Antibody information | |
| Antibody name | N185/7R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N185_7.pdf Addgene: 177508 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |