ABCD_AV264 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q16595 Homo sapiens (Human) UniProt: O35943 Mus musculus (Mouse) |
| Target name | FXN, FRDA, X25, Frataxin, Friedreich ataxia protein, Fxn |
| Epitope | Sequence:SGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA |
| Antibody information | |
| Antibody name | N191/7R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N191_7.pdf Addgene: 177511 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |