ABCD_AV264 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: Q16595 Homo sapiens (Human) UniProt: O35943 Mus musculus (Mouse) |
Target name | FXN, FRDA, X25, Frataxin, Friedreich ataxia protein, Fxn |
Epitope | Sequence:SGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA |
Antibody information | |
Antibody name | N191/7R |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: N191_7.pdf Addgene: 177511 |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|