Expasy logo

ABCD

ABCD_AV264 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q16595 Homo sapiens (Human)
UniProt: O35943 Mus musculus (Mouse)
Target name FXN, FRDA, X25, Frataxin, Friedreich ataxia protein, Fxn
Epitope Sequence:
SGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL
GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
SSLAYSGKDA
Antibody information
Antibody name N191/7R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N191_7.pdf
Addgene: 177511
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.