ABCD_AV269 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q91WF7 Mus musculus (Mouse) UniProt: Q92562 Homo sapiens (Human) UniProt: Q0Z843 Rattus norvegicus (Rat) |
| Target name | Fig4, Sac3, Polyphosphoinositide phosphatase, Phosphatidylinositol 3,5-bisphosphate 5-phosphatase, SAC domain-containing protein 3 |
| Epitope | Sequence:DTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKNTREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREDEGSISQRSTPVKMTDTGDSAKATENVVQPMKEVYGVSLSSSLSEEDHSIYARFVQLGQSQHKQDRGNQQLCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDTAMYREYIRNRYL |
| Antibody information | |
| Antibody name | N202/7 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N202_7.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |