ABCD_AV273 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q96I25 Homo sapiens (Human) UniProt: Q8JZX4 Mus musculus (Mouse) UniProt: Q6AY02 Rattus norvegicus (Rat) |
| Target name | RBM17, SPF45, Splicing factor 45, 45 kDa-splicing factor, RNA-binding motif protein 17 |
| Epitope | Sequence:YDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRP |
| Antibody information | |
| Antibody name | N219/5R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N219_5.pdf Addgene: 177515 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |