ABCD_AV273 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q96I25 UniProt: Q8JZX4 UniProt: Q6AY02 Rattus norvegicus (Rat) |
| Target name | RBM17, SPF45, Splicing factor 45, 45 kDa-splicing factor, RNA-binding motif protein 17 |
| Epitope | Sequence:YDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRP |
| Antibody information | |
| Antibody name | N219/5R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N219_5.pdf Addgene: 177515 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |