Expasy logo

ABCD

ABCD_AV275 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: O35433 Rattus norvegicus (Rat)
UniProt: Q704Y3 Mus musculus (Mouse)
Target name Trpv1, Vr1, Vr1l, Transient receptor potential cation channel subfamily V member 1, TrpV1, Capsaicin receptor, Osm-9-like TRP channel 1, OTRPC1, Vanilloid receptor 1, Vanilloid receptor type 1-like
Epitope Sequence:
MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASP
LDCPYEEGGLASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDA
VAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLK
Antibody information
Antibody name N221/17R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N221_17.pdf
Addgene: 177517
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).