ABCD_AV275 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O35433 Rattus norvegicus (Rat) UniProt: Q704Y3 Mus musculus (Mouse) |
| Target name | Trpv1, Vr1, Vr1l, Transient receptor potential cation channel subfamily V member 1, TrpV1, Capsaicin receptor, Osm-9-like TRP channel 1, OTRPC1, Vanilloid receptor 1, Vanilloid receptor type 1-like |
| Epitope | Sequence:MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASPLDCPYEEGGLASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLK |
| Antibody information | |
| Antibody name | N221/17R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N221_17.pdf Addgene: 177517 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |