ABCD_AV279 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P16305 Mus musculus (Mouse) UniProt: P30191 Rattus norvegicus (Rat) |
| Target name | Gabra6, Gabra-6, Gamma-aminobutyric acid receptor subunit alpha-6, GABA(A) receptor subunit alpha-6 |
| Epitope | Sequence:NYFTNLQSQKAERQAQTAATPPVAKSKASESLQAEIVVHSDSKYHLKKRISSLTLPIVPSSEASKALSRTPILKSTPVSPPLLLPATGGTSKIDQY |
| Antibody information | |
| Antibody name | N229A/32R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N229A_32.pdf Addgene: 164155 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |