Expasy logo

ABCD

ABCD_AV280 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P16305 Mus musculus (Mouse)
UniProt: P30191 Rattus norvegicus (Rat)
Target name Gabra6, Gabra-6, Gamma-aminobutyric acid receptor subunit alpha-6, GABA(A) receptor subunit alpha-6
Epitope Sequence:
NYFTNLQSQKAERQAQTAATPPVAKSKASESLQAEIVVHSDSKYHLKKRISSLTLPIVPS
SEASKALSRTPILKSTPVSPPLLLPATGGTSKIDQY
Antibody information
Antibody name N229A/32_b
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N229A_32.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).