ABCD_AV281 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q5S007 UniProt: F1LNJ1 |
| Target name | LRRK2, PARK8, Leucine-rich repeat serine/threonine-protein kinase 2, Dardarin |
| Epitope | Sequence:RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR |
| Antibody information | |
| Antibody name | N231B/34 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N231B_34.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |