Expasy logo

ABCD

ABCD_AV292 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P15390 Rattus norvegicus (Rat)
Target name Scn4a, Sodium channel protein type 4 subunit alpha, Mu-1, SkM1, Sodium channel protein skeletal muscle subunit alpha, Sodium channel protein type IV subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.4
Epitope Repeat I external pore between S5 and S6
Sequence:
LQLFMGNLRQKCVRWPPPMNDTNTTWYGNDTWYSNDTWYGNDTWYINDTWNSQESWAGNS
TFDWEAYINDEGNFYFLEGSNDALLCGNSSDAGHCPEGYECIKAGRNPNYGYTSYDTF
Antibody information
Antibody name N255/38
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N255_38.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).