ABCD_AV295 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P22002 Rattus norvegicus (Rat) UniProt: Q13936 Homo sapiens (Human) UniProt: Q01815 Mus musculus (Mouse) |
| Target name | Cacna1c, Cach2, Cacn2, Cacnl1a1, Cchl1a1, Voltage-dependent L-type calcium channel subunit alpha-1C, Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle, Rat brain class C, RBC, Voltage-gated calcium channel subunit alpha Cav1.2 |
| Epitope | Sequence:LARTASPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNPDTAG |
| Antibody information | |
| Antibody name | N263/31R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N263_31.pdf Addgene: 177523 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |