ABCD_AV296 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O43526 Homo sapiens (Human) UniProt: Q9Z351 Mus musculus (Mouse) UniProt: O88943 Rattus norvegicus (Rat) |
| Target name | KCNQ2, Potassium voltage-gated channel subfamily KQT member 2, KQT-like 2, Neuroblastoma-specific potassium channel subunit alpha KvLQT2, Voltage-gated potassium channel subunit Kv7.2 |
| Epitope | Sequence:MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRA |
| Antibody information | |
| Antibody name | N26A/23R |
| Applications | Western blot |
| Cross-references | NeuroMab: N26A_23.pdf Addgene: 177524 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |