Expasy logo

ABCD

ABCD_AV296 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: O43526 Homo sapiens (Human)
UniProt: Q9Z351 Mus musculus (Mouse)
UniProt: O88943 Rattus norvegicus (Rat)
Target name KCNQ2, Potassium voltage-gated channel subfamily KQT member 2, KQT-like 2, Neuroblastoma-specific potassium channel subunit alpha KvLQT2, Voltage-gated potassium channel subunit Kv7.2
Epitope Sequence:
MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRA
Antibody information
Antibody name N26A/23R
Applications Western blot
Cross-references NeuroMab: N26A_23.pdf
Addgene: 177524
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.